The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC4925
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26170,AAD36846, 2336 TM1783 Molecular Weight 43046.33 Da.
    Residues 397 Isoelectric Point 5.52
    Sequence mftprgfkfagvhckikrkrkdlgiifsevpcvaagvfttnvvkaapviydmeilkknpngikavvvnsg vanactgeqgminarrmaektaeelgvpvesvlvsstgvigvqlpmdkvengieeaarvlsndplpfae aimttdtkvkmhstkvmidgkeitvlgiakgsgmihpnmatmlsfittdakiseealkkllklsvddsy nmidvdgdtstndmvivlanglagnttiqpetdgfwklyeavhevnqvlaekivedgegatkvmevhvi napdiksarliarsivssnlvktaiygedanwgrviaaagysgatfdpekldlffeseagrikvaengq gvsfdeeeakkilsekkiriildmkqgketakawgcdltekyveingryrt
      BLAST   FFAS


    Reactions found in Metabolic Reconstruction for TM1783

    Name: ornithine transacetylase
    Metabolic Subsystem: Arginine Biosynthesis
    Reaction: : acorn + glu-L <==> acglu + orn
    Classification: EC:
    Name: N-acetylglutamate synthase
    Metabolic Subsystem: Arginine Biosynthesis
    Reaction: : accoa + glu-L --> acglu + coa + h
    Classification: EC:

    Ligand Information
    Model TM1783
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch