The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Cloned
    Target Id APC4956
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26424,AAD36889, 2336 TM1826 Molecular Weight 26703.36 Da.
    Residues 235 Isoelectric Point 8.35
    Sequence kgnshnldyvlklsekfslpvlemddvwrefvkrkllmkkkaeatlptdfgvfkvvsfenhldgkehfai vkepledpvavrihsecvtgdvlsslrcdcgsqlanflrymsahggiliylrqegrgiglsnkiaaysl qdkgldtveanrvlgfsederdyapaaqilkalgiervllftnnqrktvglekygievvetkrlygrvt phnrfylstkmkklgheleeifrevns
      BLAST   FFAS


    Reactions found in Metabolic Reconstruction for TM1826

    Name: "3,4-Dihydroxy-2-butanone-4-phosphate synthase"
    Metabolic Subsystem: Riboflavin Metabolism
    Reaction: : ru5p-D --> db4p + for + h

    Name: GTP cyclohydrolase II
    Metabolic Subsystem: Riboflavin Metabolism
    Reaction: : gtp + h2o --> 25dhpp + for + h + ppi
    Classification: EC:

    Ligand Information
    Model TM1826
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch