The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC4968
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26224,AAD36910, 2336 TM1848 Molecular Weight 93495.06 Da.
    Residues 813 Isoelectric Point 5.79
    Sequence mrfgyfddvnreyvittpqtpypwinylgtedffsiishmaggycfykdarlrritrfrynnvptdaggr yfyireengdfwtptwmpvrkdlsffearhglgytkitgernglratityfvprhftgevhylvlenka ekprkiklfsfiefclwnalddmtnfqrnystgeveiegsviyhkteyrerrnhyafysvnqpidgfdt dresfiglysgfeapqavvegkprnsvasgwapiashyleielapsekkelifilgyvenpeeekwekp gvinkkrakemiekfktgedvehalkelreywddllgriqvethdeklnrmvniwnqyqcmvtfnisrs asyfesgisrgigfrdsnqdilgfvhmipekarqrildlasiqfedgstyhqfqpltkkgnneigggfn ddplwlilstsayiketgdwsilgeevpfdndpnkkaslfehlkrsfyftvnnlgphglpligradwnd clnlncfsknpdesfqttvnaldgrvaesvfiaglfvlagkefveickrrgleeeareaekhvnkmiet tlkygwdgewflraydafgrkvgskeceegkifiepqgmcvmagigvdngyaekaldsvkkyldtpygl vlqqpaysryyielgeissyppgykenagifchnnpwvaiaetvigrgdrafeiyrkitpayledisei hrtepyvyaqmvagkdaprhgeaknswltgtaawsfvaitqhilgirptydslvvdpcipkewegfrit rkfrgsiyditvknpshvskgvkeiivdgkkiegqvlpvfedgkvhrvevvmg
      BLAST   FFAS


    Reactions found in Metabolic Reconstruction for TM1848

    Name: cellobiose phosphorylase
    Metabolic Subsystem: Cellulose Metabolism
    Reaction: : cellb + pi <==> g1p + glc-D
    Classification: EC:

    Ligand Information
    Model TM1848
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch