.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC5570

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site Midwest Center for Structural Genomics
    Status Diffraction
    Target Id APC5570
    Molecular Characteristics
    Source Archaeoglobus fulgidus dsm 4304
    Alias Ids TPS4698, Molecular Weight 25945.86 Da.
    Residues 236 Isoelectric Point 4.79
    Sequence mgavsafswassgrlhalevfvmkipktydeimehfgglidevtaellesyakgetvrvsealaksgrvavegvvl rvfpvrhfskngrsgkvgsvviqddctvrvnfwneaaeiieagdivegarikvrgyargeeihvnslsevevfvd fvniseldekvgervnvkgfvsglgepekaneiyisdetgrvkvlleneslyyavdigsyveiynalagedgiyv drnsrfsvge
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch