The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Crystallized
    Target Id APC5641
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS4735,AAD35246.1, 243274 TM0153 Molecular Weight 14245.56 Da.
    Residues 122 Isoelectric Point 5.08
    Sequence mktaildrfvfsdevrdiienapeiiipesrkeildlaiagrdlfevgyevpgkgfvveatvtrcknglv vnypepymrrrdpnalvvgdnletdkprfrerfgkefepirqetfewlkkqe
      BLAST   FFAS

    Ligand Information
    Model TM0153
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch