.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC5892

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site Midwest Center for Structural Genomics
    Status Diffraction
    Target Id APC5892
    Molecular Characteristics
    Source Nitrosomonas europaea atcc 19718
    Alias Ids TPS4905, Molecular Weight 25048.60 Da.
    Residues 213 Isoelectric Point 6.72
    Sequence mtinndpmrdaivdtavelaahtsweavrlydiaarlavsldeirlyfrekdelidawfdradsrmlkeaesagfl dlvaserihhlimiwldalavqrkvtrqmimsklefghihiqipavmrvsrtvqwvreaaqrdatfmrraleest lttiylmtfffwmrdesensrhtrqflkrhltmaawlgqkvygkdpekstvphkqqiplqfd
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch