.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC6522

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC6522
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS26186,AAD36289.1, 243274 TM1214 Molecular Weight 20957.93 Da.
    Residues 178 Isoelectric Point 6.33
    Sequence mkersiweriadnlrsrsiwmlhyctgcgavelppsmtsrfdmerfgiapmatprqadillitgylntkt lrrviytyeqmpdpkyvvgfgsctinggiyfdsyatvnrldyyipvdvyiagcmprpeaileafnylme kirkgeadgwkryrenyewykqnqirslgevyvhdefhe
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1214

    Name: NADH dehydrogenase
    Other genes that carryout this rxn:TM1105 TM1212 TM1211 TM1216 TM0012 T
    Metabolic Subsystem: Energy Metabolism
    Reaction: h[c] + nadh[c] + q[c] --> h[e] + nad[c] + qh2[c]
    Classification: EC:1.6.5.3
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1214
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch