.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC65581.2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Selected
    Target Id APC65581.2
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS26196,NP_228364.1, 3.30.499.10, 243274 TM0554 Molecular Weight 13633.28 Da.
    Residues 122 Isoelectric Point 6.84
    Sequence mtlaekilsqkagrkvepgeflllepdialanditaplaikkfkeyggkkvkypdrvvlvpdhftpnkdi ksamqvkmmrefareqgiekffeigrmgiehvllpeegivksgdlvvgadsh
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0554

    Name: 2-isopropylmalate hydratase
    Other genes that carryout this rxn: TM0555
    Metabolic Subsystem: "Valine, Leucine, and Isoleucine Metabolism"
    Reaction: : 2ippm + h2o <==> 3c3hmp
    Classification: EC:4.2.1.33
     
    Name: 3-isopropylmalate dehydratase
    Other genes that carryout this rxn: TM0555
    Metabolic Subsystem: "Valine, Leucine, and Isoleucine Metabolism"
    Reaction: : 3c2hmp <==> 2ippm + h2o
    Classification: EC:4.2.1.33
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0554
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch