.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC65584.1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Selected
    Target Id APC65584.1
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS26164,NP_228048.1, 3.40.50.720, 243274 TM0234 Molecular Weight 10096.04 Da.
    Residues 90 Isoelectric Point 5.89
    Sequence mkigflgfgksnrsllkyllnhqeakffvseaktldgetkkfleehsveyeegghteklldcdvvyvspg ikpdtsmiellssrgvklst
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0234

    Name: UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
    Metabolic Subsystem: Peptidoglycan Biosynthesis
    Reaction: : atp + glu-D + uama --> adp + h + pi + uamag
    Classification: EC:6.3.2.9
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0234
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch