The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site Midwest Center for Structural Genomics
    Status Crystallized
    Target Id APC7263
    Molecular Characteristics
    Source Pseudomonas syringae pv. tomato str. dc3000
    Alias Ids TPS5103, Molecular Weight 28991.33 Da.
    Residues 259 Isoelectric Point 9.13
    Sequence akqaaqstfnsfhewakqaeamrnpsrmdiykiykqdaphshpmsdeqqeeflhtlkalngkngievrtqdhdsvr nkkdrnldkyiaespdakrffyriipkherredknqgrltigvqpqyatqltramatligkesaithgkvigpac hgqmtdsavlyingdvakaeklgeklkqmsgipldafvehtplsmqslskglsyaesilgdtrghgmsraevisd alrmdgmpflarlklslsangydpdnpalrntk
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch