.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC7599

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC7599
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS33006,NP_460322.1, 99287 TM1356 Molecular Weight 42987.79 Da.
    Residues 383 Isoelectric Point 5.18
    Sequence mdfslteeqelllasirelitsnfpeeyfrtcdqtgtypkefmqalaengismlgvpeefggipadyvtq mlalmeiskcgapaflitngqcihsmrrfgsaeqlrktaestlatgdpayalaltepgagsdnnsattt wtrkngkvylngqktfitgakeypymlvlardtepkdpkkaftlwwvdsnkpgikinplhkigwhmlst cevyldnvevdesdrvgeegmgflnvmynfemerlinaarstgfaecafedaaryanqriafgkpighn qmiqeklalmaikienmrnmvlkvawqadreeslrtsaalaklycartameviddaiqimgglgytdea rvsrfwrdvrcerigggtdeimiyvagrqilkdyqnk
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Transmembrane protein

    HMM_TM1356

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch