.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC81193

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site Midwest Center for Structural Genomics
    Status Crystallized
    Target Id APC81193
    Molecular Characteristics
    Source Porphyromonas gingivalis w83
    Alias Ids TPS5646, Molecular Weight 41080.45 Da.
    Residues 361 Isoelectric Point 5.14
    Sequence mavkdnycvimgggigsrfwpfsreshpkqfldffgtgrsllqmtydrfarfiprenilvvtnelyvdkvreqlpe iepdqilreptrrntapciayasyhiyarnpkaniivapsdhlilredefvraasealefvadhehlvtlgirps rpetgygyiqmaeektgdfirvktftekpnaemasiflasgeflwnsgmfvwnvesilaafrkhlpevtssleng lahfntpeerrfidqafpycpsisidfgvmekadnvlvmpvdfgwadlgtwgslyelaqkddagnaslktrtlfy eaernivttdnpqklvvvqgindcivaesgnvllicraeeeqrikhfvadaalkydkeyn
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch