.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC86014.3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site Midwest Center for Structural Genomics
    Status Crystallized
    Target Id APC86014.3
    Molecular Characteristics
    Source Legionella pneumophila subsp. pneumophila str. philadelphia 1
    Alias Ids TPS5806, Molecular Weight 32746.25 Da.
    Residues 302 Isoelectric Point 6.88
    Sequence aqnstvkingltlvqssnqlneaitgvtidlkkaeigkivtltvddnkdqltglinefikqyndtmtfltnltgyn netkqggvfqgdpqfrnlklnlnkwattplanqegpirsladlgiitnkqglleikqdkfktaldnhykeigalf aktakandtginvksinstvksgtydvvlteftpgvsmsgtigglsaissdgitltgsadlsglsinvfsgsags rgqitvtdgiavqlsslldayieikgdleqrkdqlnnqvkqlnkiqneidirrksietrylkqftaldtllsqlq s
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch