.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC90014.3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site Midwest Center for Structural Genomics
    Status Crystallized
    Target Id APC90014.3
    Molecular Characteristics
    Source Caenorhabditis elegans
    Alias Ids TPS5963, Molecular Weight 42939.55 Da.
    Residues 388 Isoelectric Point 6.10
    Sequence astekeekmgtiigidlgttyscvgvfkngrveiiandqgnritpsyvafsgdqgerligdaaknqltinpentif dakrligrfynektvqqdikhwpfkivdksnkpnvevkvgsetkqftpeevsamvltkmkqiaesylghevknav vtvpayfndaqkqatkdagsiaglnvvriineptaaaiaygldkkdgernilvfdlgggtfdvslltidsgvfev latngdthlggedfdqrvmeyfiklykkksgkdlrkdnravqklrrevekakralstqhqtkieieslfdgedfs etltrakfeelnmdlfratlkpvqkvledadmkktdvheivlvggstripkvqqlikdyfngkepsrginpdeav aygaavqagvig
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch