.
The Open Protein Structure Annotation Network
PDB Keyword
.

VR122

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site NESG
    Status Selected
    Target Id VR122
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS32688,PF08668, 1.10.3150.10, 1.20.5.620, 3.30.1370.10, BIG_696, PF01966, 1.10.3210.10, PF00013 TM1857 Molecular Weight 58167.73 Da.
    Residues 508 Isoelectric Point 5.57
    Sequence mmlwyivagagglligylianyqinqklrkakedaqtiiekaekeaneikkkaiiegreevhrlreefek ersrreeelraleerllkreelltrkeenlekreqqveelkanleekmreveekekrideelkrlagmt veearelileearqryehdlaklykemkeqveeeaekeakkviafavqryapdyvgeitvstvslpsdd mkgriigregrnirtfekitgvdliiddtpevvvlscfnplrreiaritleklvadgrihparieemye kakqevekaikeagqeatfkagvmglhpelvkllgklkyrtsygqnvlnhsievallagymaselglna dkarrggllhdigkavdqelegshttigaelarrygekediinmilshhgeeepmtpeavlvaaadals aarpgarreslenyikrlmkleeiaksfkyvekayaiqagreirvivepdkvddalaeklaydiskkie eeleypgvlkvvvirekrsvayak
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1857
    generated 12/2008
    Transmembrane protein

    HMM_TM1857

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch