.
The Open Protein Structure Annotation Network
PDB Keyword
.

VR78

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site NESG
    Status Mass spec verified
    Target Id VR78
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS32238,PF04055, PF00919, 3.20.20.70 TM0830 Molecular Weight 49321.52 Da.
    Residues 434 Isoelectric Point 9.23
    Sequence mktvrietfgckvnqyeseymaeqlekagyvvlpdgnaayyivnscavtkevekkvkrliksirnrnkna kiiltgcfaqlspdeaknlpvdmvlgidekkhivdhinslngkqqvvvsepgrpvyekvkgsfedrtrs yikvedgcdntctycairlargtrirskpleifkeefaemvmkgykeivitgvnlgkygkdmgsslael lkviekvpgdyrvrlssinvedvndeivkafkrnprlcphlhisvqsgsddvlkrmgrkykisdfmrvv dklrsidpdfsittdiivgfpgetdadfqrtlelvekvefsrvhifrfsprpgtpasrmeggvpeskkk erldvlkekakdvsiryrkriigkerkvlaewyvmkgvlsgydeyyvkhefvgnrvgefhsvrvkslse egviscradmvegkvparg
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0830
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch