.
The Open Protein Structure Annotation Network
PDB Keyword
.

VR90

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site NESG
    Status Expressed
    Target Id VR90
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS32321,PF01875 TM0087 Molecular Weight 30474.40 Da.
    Residues 277 Isoelectric Point 4.80
    Sequence mkrkpavaglfypsrrdelieqirmcfldkrigpgklpgpvetklqnpiglvsphagyiysgpvaawgfl eavkfgepsvvviigpnhtglgrpvgvwpegewetplgtvpvneraveivlsnsryaeedfmshirehs ievqipflqfvfgevsivpiclmdqspavaedlasalaklvaefpgvliiastdlnhyedqrttlrkds yiieaiegmdpsllyeylvredismcgyggvatllnmdfenvrilkhatsgdvsgdtlevvgylsailf
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0087
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch