.
The Open Protein Structure Annotation Network
PDB Keyword
.

VT21

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site NESG
    Status Cloned
    Target Id VT21
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS32641,3.30.1490.150, PF01871, 3.30.700.20 TM1551 Molecular Weight 19787.63 Da.
    Residues 174 Isoelectric Point 5.08
    Sequence migehpyvkwairvienyvrygkviepdesvpeelfkrragafvtlhktdgslrgcigtylptkpnlale irdnaiaaatqdprfppvspdelddivvhvdilsppepvrdiseldpkkygvivvkgwrrglllpdieg vdtveeqlriaklkagipewdddveiyrftveryk
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1551
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch