.
The Open Protein Structure Annotation Network
PDB Keyword
.

VT82

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site NESG
    Status Purified
    Target Id VT82
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS32879,PF01809 TM1462 Molecular Weight 9621.00 Da.
    Residues 81 Isoelectric Point 10.41
    Sequence mkkllimlirfyqryisplkpptcrftptcsnyfiqalekhgllkgtflglrrilrcnplskggydpvpe efsfkprrrws
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch