.
The Open Protein Structure Annotation Network
PDB Keyword
.

1dv7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Electrostatic stress in catalysis: structure and mechanism of the enzyme orotidine monophosphate decarboxylase. Proc.Natl.Acad.Sci.USA 97 2017-2022 2000
    Site NESGC
    PDB Id 1dv7 Target Id TT2
    Molecular Characteristics
    Source Methanothermobacter thermautotrophicus
    Alias Ids TPS9199,PF00215, 3.20.20.70 Molecular Weight 24723.05 Da.
    Residues 227 Isoelectric Point 5.02
    Sequence rsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiad fkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpgaemfiqgaa deiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggdpgetlrfadaiivgrsiyla dnpaaaaagiiesikdllnp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.2220000
    Matthews' coefficent 2.03 Rfactor 0.2000000
    Waters 217 Solvent Content 39.45

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1dv7
    1. Computer simulations of enzyme catalysis: methods, progress, and insights
    A Warshel - Annual review of biophysics and biomolecular , 2003 - annualreviews.org
     
    2. Electrostatic stress in catalysis: structure and mechanism of the enzyme orotidine monophosphate decarboxylase
    N Wu, Y Mo, J Gao, EF Pai - Proceedings of the National , 2000 - National Acad Sciences
     
    3. Structural proteomics of an archaeon
    D Christendat, A Yee, A Dharamsi, Y Kluger - nature structural , 2000 - pdg.cnb.uam.es
     
    4. Structural proteomics: toward high-throughput structural biology as a tool in functional genomics
    A Yee, K Pardee, D Christendat - Accounts of chemical , 2003 - ACS Publications
     
    5. Effective factors in thermostability of thermophilic proteins
    M Sadeghi, H Naderi-Manesh, M Zarrabi - Biophysical chemistry, 2006 - Elsevier
     
    6. Circe effect versus enzyme preorganization: what can be learned from the structure of the most proficient enzyme?
    A Warshel, J Florin, M trajbl, J Vill - ChemBioChem, 2001 - Wiley Online Library
     
    7. A potent, covalent inhibitor of orotidine 5'-monophosphate decarboxylase with antimalarial activity
    AM Bello, E Poduch, M Fujihashi, M Amani - Journal of medicinal , 2007 - ACS Publications
     
    8. Substrate binding induces domain movements in orotidine 5'-monophosphate decarboxylase
    P Harris, JCN Poulsen, KF Jensen, S Larsen - Journal of molecular biology, 2002 - Elsevier
     
    9. Structural basis for the decarboxylation of orotidine 5_-monophosphate (OMP) by Plasmodium falciparum OMP decarboxylase
    K Tokuoka, Y Kusakari, SR Krungkrai - Journal of , 2008 - Jpn Biochemical Soc
     
    10. Mechanism of the orotidine 5_-monophosphate decarboxylase-catalyzed reaction: evidence for substrate destabilization
    KK Chan, BMK Wood, AA Fedorov, EV Fedorov - Biochemistry, 2009 - ACS Publications
     
    11. Structure and Inhibition of Orotidine 5_-Monophosphate Decarboxylase from Plasmodium falciparum
    DB Langley, M Shojaei, C Chan, HC Lok - Biochemistry, 2008 - ACS Publications
     
    12. Computer-based screening of functional conformers of proteins
    HMM Molina, C Milln-Pacheco, N Pastor - PLoS Computational , 2008 - dx.plos.org
     
    13. Pyrimidine Derivatives As Anticancer Agents
    LP Kotra, EF Pai, CJ Paige, AM Bello - US Patent App. 12/522,511, 2008 - Google Patents
     
    14. pK (a) prediction of residues in proteins and theoretical studies of enzyme mechanisms
    CL Stanton - 2007 - books.google.com
     
    15. _________________
    ___ ____ ___ ____ ____ ___ - ____, 2010 - sioc-journal.cn
     
    16. Crystallographic structure refinement
    P Afonine - phenix-online.org
     
    17. Iterative Protein Alignment Algorithm (IPA)
    TV Kirys, SI Feranchuk, AV Tuzikov, J Rocha - dmi.uib.es
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch