.
The Open Protein Structure Annotation Network
PDB Keyword
.

1eij

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural proteomics of an archaeon. Nat.Struct.Biol. 7 903-909 2000
    Site NESGC
    PDB Id 1eij Target Id TT10
    Molecular Characteristics
    Source Methanothermobacter thermautotrophicus
    Alias Ids TPS9193,1.10.8.140, 4674, PF01984 Molecular Weight 13272.07 Da.
    Residues 111 Isoelectric Point 10.12
    Sequence mtdleeirrkkmlelqqkaqqqameaeaqeqmrqqlemqkkqimmqiltpearsrlanlrltrpdfveq ielqliqlaqmgrvrskitdeqlkellkrvagkkreikisrk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1eij
    1. Structural proteomics of an archaeon
    D Christendat, A Yee, A Dharamsi, Y Kluger - nature structural , 2000 - pdg.cnb.uam.es
     
    2. Structural proteomics: toward high-throughput structural biology as a tool in functional genomics
    A Yee, K Pardee, D Christendat - Accounts of chemical , 2003 - ACS Publications
     
    3. Natively unstructured loops differ from other loops
    A Schlessinger, J Liu, B Rost - PLoS computational biology, 2007 - dx.plos.org
     
    4. Novel approach for __helical topology prediction in globular proteins: Generation of interhelical restraints
    SR McAllister, BE Mickus, JL Klepeis - Proteins: Structure, , 2006 - Wiley Online Library
     
    5. Solution structure of the coiled-coil trimerization domain from lung surfactant protein D
    H Kovacs, SI O'Donoghue, HJ Hoppe - Journal of biomolecular , 2002 - Springer
     
    6. Solution structure of S. cerevisiae PDCD5-like protein and its promoting role in H2O2-induced apoptosis in yeast
    J Hong, J Zhang, Z Liu, S Qin, J Wu, Y Shi - Biochemistry, 2009 - ACS Publications
     
    7. Structure-function correlation of human programmed cell death 5 protein
    H Yao, L Xu, Y Feng, D Liu, Y Chen, J Wang - Archives of biochemistry and , 2009 - Elsevier
     
    8. Predicted consequences of site-directed mutagenesis and the impact of species variation on prion protein misfolding through the N-terminal domain
    DP Molloy, B Chen - Journal of molecular modeling, 2005 - Springer
     
    9. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     
    10. 7. Entropy analysis of enzymes with QSAR, partial order, and 3D-contact networks
    R Concu, G Podda, B Shen, H Gonzlez-Daz - trnres.com
     
    11. Protein Folding with Coarse-Grained Off-Lattice Models of the Polypeptide Chain
    M Nanias - 2005 - ecommons.library.cornell.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch