.
The Open Protein Structure Annotation Network
PDB Keyword
.

1eik

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the RNA polymerase subunit RPB5 from Methanobacterium thermoautotrophicum. Proc.Natl.Acad.Sci.USA 97 6311-6315 2000
    Site NESGC
    PDB Id 1eik Target Id TT9
    Molecular Characteristics
    Source Methanothermobacter thermautotrophicus
    Alias Ids TPS9216,PF01191, 4678, 3.90.940.20 Molecular Weight 8807.88 Da.
    Residues 77 Isoelectric Point 9.35
    Sequence mkreilkhqlvpehvilneseakrvlkeldahpeqlpkikttdpvakaigakrgdivkiirksptaeef vtyrlvqd
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1eik
    1. Structural proteomics of an archaeon
    D Christendat, A Yee, A Dharamsi, Y Kluger - nature structural , 2000 - pdg.cnb.uam.es
     
    2. Structural proteomics: toward high-throughput structural biology as a tool in functional genomics
    A Yee, K Pardee, D Christendat - Accounts of chemical , 2003 - ACS Publications
     
    3. Zinc-bundle structure of the essential RNA polymerase subunit RPB10 from Methanobacterium thermoautotrophicum
    CD Mackereth, CH Arrowsmith - Proceedings of the , 2000 - National Acad Sciences
     
    4. Solution structure of the RNA polymerase subunit RPB5 from Methanobacterium thermoautotrophicum
    A Yee, V Booth, A Dharamsi, A Engel - Proceedings of the , 2000 - National Acad Sciences
     
    5. Recognizing protein folds by cluster distance geometry
    GM Crippen - Proteins: Structure, Function, and Bioinformatics, 2005 - Wiley Online Library
     
    6. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     
    7. A new computationally facile analytical approximation of electrostatic potential suitable for macromolecules.
    JC Gordon - 2007 - scholar.lib.vt.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch