.
The Open Protein Structure Annotation Network
PDB Keyword
.

1eiw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure-based functional classification of hypothetical protein MTH538 from Methanobacterium thermoautotrophicum. J.Mol.Biol. 302 189-203 2000
    Site NESGC
    PDB Id 1eiw Target Id TP1
    Molecular Characteristics
    Source Methanothermobacter thermautotrophicus
    Alias Ids TPS9185,4793, 3.40.50.9200 Molecular Weight 12383.30 Da.
    Residues 111 Isoelectric Point 4.40
    Sequence vtaeirlyitegevedyrvflerleqsglewrpatpedadavivlaglwgtrrdeilgavdlarksskp iitvrpyglenvppeleavssevvgwnphcirdaledaldvi
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1eiw
    1. Automated prediction of protein function and detection of functional sites from structure
    F Pazos, MJE Sternberg - of Sciences of the United States , 2004 - National Acad Sciences
     
    2. Structural proteomics of an archaeon
    D Christendat, A Yee, A Dharamsi, Y Kluger - nature structural , 2000 - pdg.cnb.uam.es
     
    3. Structural proteomics: toward high-throughput structural biology as a tool in functional genomics
    A Yee, K Pardee, D Christendat - Accounts of chemical , 2003 - ACS Publications
     
    4. Accurate and automated classification of protein secondary structure with PsiCSI
    LH Hung, R Samudrala - Protein science, 2003 - Wiley Online Library
     
    5. Local structure-based sequence profile database for local and global protein structure predictions
    AS Yang, L Wang - Bioinformatics, 2002 - Oxford Univ Press
     
    6. Structure-based functional classification of hypothetical protein MTH538 from Methanobacterium thermoautotrophicum1
    JR Cort, A Yee, AM Edwards, CH Arrowsmith - Journal of molecular , 2000 - Elsevier
     
    7. Recognizing protein folds by cluster distance geometry
    GM Crippen - Proteins: Structure, Function, and Bioinformatics, 2005 - Wiley Online Library
     
    8. Superimposition of protein structures with dynamically weighted RMSD
    D Wu, Z Wu - Journal of Molecular Modeling, 2010 - Springer
     
    9. Derivation and analysis of fragment libraries of protein structures
    IY Lee, TT Soong, JM Hoo - , 2004. BIBE 2004. , 2004 - ieeexplore.ieee.org
     
    10. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     
    11. Predicted consequences of site-directed mutagenesis and the impact of species variation on prion protein misfolding through the N-terminal domain
    DP Molloy, B Chen - Journal of molecular modeling, 2005 - Springer
     
    12. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     
    13. A new computationally facile analytical approximation of electrostatic potential suitable for macromolecules.
    JC Gordon - 2007 - scholar.lib.vt.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch