.
The Open Protein Structure Annotation Network
PDB Keyword
.

1eo0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a conserved domain common to the transcription factors TFIIS, elongin A, and CRSP70. J.Biol.Chem. 275 31266-31268 2000
    Site NESGC
    PDB Id 1eo0 Target Id YT101
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS9260,1.20.930.10, PF08711, 4726 Molecular Weight 12539.73 Da.
    Residues 111 Isoelectric Point 9.33
    Sequence mdskevlvhvknleknksndaavleilhvldkefvptekllretkvgvevnkfkkstnveisklvkkmi sswkdainknkrsrqaqqhhqdhapgnaedkttvgesvngvq
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1eo0
    1. Protein NMR recall, precision, and F-measure scores (RPF scores): structure quality assessment measures based on information retrieval statistics
    YJ Huang, R Powers - Journal of the American , 2005 - ACS Publications
     
    2. The vaccinia virus N1L protein is an intracellular homodimer that promotes virulence
    N Bartlett, JA Symons, DC Tscharke - Journal of general , 2002 - Soc General Microbiol
     
    3. The _29 DNA polymerase: protein-primer structure suggests a model for the initiation to elongation transition
    S Kamtekar, AJ Berman, J Wang, JM Lzaro - The EMBO , 2006 - nature.com
     
    4. Natively unstructured loops differ from other loops
    A Schlessinger, J Liu, B Rost - PLoS computational biology, 2007 - dx.plos.org
     
    5. Accurate and automated classification of protein secondary structure with PsiCSI
    LH Hung, R Samudrala - Protein science, 2003 - Wiley Online Library
     
    6. Folding of small helical proteins assisted by small-angle X-ray scattering profiles
    Y Wu, X Tian, M Lu, M Chen, Q Wang, J Ma - Structure, 2005 - Elsevier
     
    7. Determining protein topology from skeletons of secondary structures
    Y Wu, M Chen, M Lu, Q Wang, J Ma - Journal of molecular biology, 2005 - Elsevier
     
    8. Structural characterization and comparative phylogenetic analysis of Escherichia coli HemK, a protein (N5)-glutamine methyltransferase
    Z Yang, L Shipman, M Zhang, BP Anton - Journal of molecular , 2004 - Elsevier
     
    9. The role of a priori information in the minimization of contact potentials by means of estimation of distribution algorithms
    R Santana, P Larraaga, J Lozano - Machine Learning and Data Mining in , 2007 - Springer
     
    10. Novel approach for __helical topology prediction in globular proteins: Generation of interhelical restraints
    SR McAllister, BE Mickus, JL Klepeis - Proteins: Structure, , 2006 - Wiley Online Library
     
    11. The structure of an Iws1/Spt6 complex reveals an interaction domain conserved in TFIIS, Elongin A and Med26
    ML Diebold, M Koch, E Loeliger, V Cura, F Winston - The EMBO , 2010 - nature.com
     
    12. Structural characterization of the DAXX N-terminal helical bundle domain and its complex with Rassf1C
    E Escobar-Cabrera, DKW Lau, S Giovinazzi, AM Ishov - Structure, 2010 - Elsevier
     
    13. Understanding the role of the topology in protein folding by computational inverse folding experiments
    A Mucherino, S Costantini, D di Serafino - Biology and Chemistry, 2008 - Elsevier
     
    14. Crystallization and preliminary crystallographic analysis of eukaryotic transcription and mRNA export factor Iws1 from Encephalitozoon cuniculi
    M Koch, ML Diebold, J Cavarelli - Section F: Structural , 2010 - scripts.iucr.org
     
    15. Conformational Selection of the AGA* IAM Heparin Pentasaccharide when Bound to the Fibroblast Growth Factor Receptor
    L Nieto, Canales, G Gimnez_Gallego - -A European Journal, 2011 - Wiley Online Library
     
    16. Folding helical proteins in explicit solvent using dihedral-biased tempering
    C Zhang, J Ma - Proceedings of the National Academy of , 2012 - National Acad Sciences
     
    17. Modeling Protein Structures Based on Density Maps at Intermediate Resolutions
    J Ma - Computational Methods for Protein Structure Prediction , 2007 - Springer
     
    18. A new computationally facile analytical approximation of electrostatic potential suitable for macromolecules.
    JC Gordon - 2007 - scholar.lib.vt.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch