.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ep0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of dTDP-4-keto-6-deoxy-D-hexulose 3,5-epimerase from Methanobacterium thermoautotrophicum complexed with dTDP. J.Biol.Chem. 275 24608-24612 2000
    Site NESGC
    PDB Id 1ep0 Target Id TT3
    Molecular Characteristics
    Source Methanothermobacter thermautotrophicus
    Alias Ids TPS9204,2.60.120.10, PF00908 Molecular Weight 21677.26 Da.
    Residues 185 Isoelectric Point 4.56
    Sequence maefrfiktsldgaiiiepevytdergyfmetfneaifqenglevrfvqdnesmsvrgvlrglhfqrek pqgklvrvirgeifdvavdlrknsdtygewtgvrlsdenrreffipegfahgflalsdecivnykctel yhpeydsgipwddpdigidwplemvddliisekdrnwkplrenpvyl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.21
    Matthews' coefficent 2.13 Rfactor 0.183
    Waters 126 Solvent Content 42.18

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ep0
    1. Are acidic and basic groups in buried proteins predicted to be ionized?
    J Kim, J Mao, MR Gunner - Journal of molecular biology, 2005 - Elsevier
     
    2. Protein secondary structure assignment through Voronoi tessellation
    F Dupuis, JF Sadoc, JP Mornon - Proteins: Structure, Function, , 2004 - Wiley Online Library
     
    3. AS2TS system for protein structure modeling and analysis
    A Zemla, CE Zhou, T Slezak, T Kuczmarski - Nucleic acids , 2005 - Oxford Univ Press
     
    4. Optimization of protein force-field parameters with the Protein Data Bank
    Y Sakae, Y Okamoto - Chemical physics letters, 2003 - Elsevier
     
    5. The MASH pipeline for protein function prediction and an algorithm for the geometric refinement of 3D motifs
    BY Chen, VY Fofanov, DH Bryant - Journal of , 2007 - online.liebertpub.com
     
    6. Mycobacterium tuberculosis RmlC epimerase (Rv3465): a promising drug-target structure in the rhamnose pathway
    KA Kantardjieff, CY Kim, C Naranjo - Section D: Biological , 2004 - scripts.iucr.org
     
    7. The 1.6_ resolution crystal structure of NovW: A 4_keto_6_deoxy sugar epimerase from the novobiocin biosynthetic gene cluster of Streptomyces spheroides
    P Jakimowicz, M Tello, CL Freel Meyers - Proteins: Structure, , 2006 - Wiley Online Library
     
    8. A Survey of Aspartate-Phenylalanine and Glutamate-Phenylalanine Interactions in the Protein Data Bank: Searching for Anion-Pi Pairs
    V Philip, JB Harris, RM Adams, D Nguyen, J Spiers - Biochemistry, 2011 - ACS Publications
     
    9. Tyl1a, a TDP_6_deoxy_D_xylo_4_hexulose 3, 4_isomerase from Streptomyces fradiae: Structure Prediction, Mutagenesis and Solvent Isotope Incorporation
    M Tello, M Rejzek, B Wilkinson, DM Lawson - , 2008 - Wiley Online Library
     
    10. A statistical model to correct systematic bias introduced by algorithmic thresholds in protein structural comparison algorithms
    VY Fofanov, BY Chen, DH Bryant - , 2008. BIBMW 2008. , 2008 - ieeexplore.ieee.org
     
    11. Crystallization and preliminary X-ray studies on the putative dTDP sugar epimerase NovW from the novobiocin biosynthetic cluster of Streptomyces spheroides
    P Jakimowicz, CL Freel Meyers, CT Walsh - Section D: Biological , 2003 - scripts.iucr.org
     
    12. A novel predicting algorithm of thermostable proteins based on choquet integral with respect to L-measure and hurst exponent
    JI Shieh, YL Liu, KJ Lee, PC Chang - Machine Learning and , 2009 - ieeexplore.ieee.org
     
    13. Computational and experimental investigations of forces in protein folding
    DA Schell - 2003 - txspace.di.tamu.edu
     
    14. Structural and functional dissection of aminocoumarin antibiotic biosynthesis: a review
    DM Lawson, CEM Stevenson - Journal of structural and functional , 2012 - Springer
     
    15. Optimizations of protein force fields
    Y Sakae, Y Okamoto - Arxiv preprint arXiv:1208.6150, 2012 - arxiv.org
     
    16. A Linear Function for the Approximation of Accessible Surface Area of Proteins
    RG Kim, CY Choi - Protein and Peptide Letters, 2006 - ingentaconnect.com
     
    17. Fragment Library-Based Representation System for Protein Conformation
    R Kim, CY Choi - Protein and Peptide Letters, 2006 - ingentaconnect.com
     
    18. A new computationally facile analytical approximation of electrostatic potential suitable for macromolecules.
    JC Gordon - 2007 - scholar.lib.vt.edu
     
    19. Vicilin and Legumin Seed Storage Proteins, Structure, Function, and Evolution of
    JM Dunwell - Biopolymers Online - Wiley Online Library
     
    20. Rosario Ivetth Corona de la Fuente
    YAPORELS COMIT - estudiantes.cicese.mx
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch