.
The Open Protein Structure Annotation Network
PDB Keyword
.

1f35

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the olfactory marker protein at 2.3 A resolution. J.Mol.Biol. 319 807-821 2002
    Site NESGC
    PDB Id 1f35 Target Id HC1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS8904,2.60.120.390, PF06554 Molecular Weight 18865.61 Da.
    Residues 163 Isoelectric Point 5.00
    Sequence maedgpqkqqlemplvldqdltqqmrlrveslkqrgekkqdgeklirpaesvyrldfiqqqklqfdhwn vvldkpgkvtitgtsqnwtpdltnlmtrqlldpaaifwrkedsdamdwneadalefgerlsdlakirkv myflitfgegvepanlkasvvfnql
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.2470000
    Matthews' coefficent 4.75 Rfactor 0.2100000
    Waters 176 Solvent Content 74.09

    Ligand Information
    Ligands CAC (CACODYLATE) x 1
    Metals ZN (ZINC) x 10

    Jmol

     
    Google Scholar output for 1f35
    1. 3D_SHOTGUN: A novel, cooperative, fold_recognition meta_predictor
    D Fischer - Proteins: Structure, Function, and Bioinformatics, 2003 - Wiley Online Library
     
    2. An accurate, residue_level, pair potential of mean force for folding and binding based on the distance_scaled, ideal_gas reference state
    C Zhang, S Liu, H Zhou, Y Zhou - Protein science, 2004 - Wiley Online Library
     
    3. Amino acid empirical contact energy definitions for fold recognition in the space of contact maps
    M Berrera, H Molinari, F Fogolari - BMC bioinformatics, 2003 - biomedcentral.com
     
    4. Optimisation of NMR dynamic models II. A new methodology for the dual optimisation of the model-free parameters and the Brownian rotational diffusion tensor
    EJ d'Auvergne, PR Gooley - Journal of biomolecular NMR, 2008 - Springer
     
    5. The crystal structure of the olfactory marker protein at 2.3 resolution
    PC Smith, S Firestein, JF Hunt - Journal of molecular biology, 2002 - Elsevier
     
    6. A simple way to compute protein dynamics without a mechanical model
    CH Shih, SW Huang, SC Yen, YL Lai - PROTEINS: , 2007 - Wiley Online Library
     
    7. A fold-recognition approach to loop modeling
    C Levefelt, D Lundh - Journal of molecular modeling, 2006 - Springer
     
    8. A novel fingerprint for the characterization of protein folds
    M Mezei - Protein engineering, 2003 - Oxford Univ Press
     
    9. relaxGUI: a new software for fast and simple NMR relaxation data analysis and calculation of ps-ns and _s motion of proteins
    M Bieri, EJ d'Auvergne, PR Gooley - Journal of biomolecular NMR, 2011 - Springer
     
    10. A statistical analysis of prote in-prote in interaction with knowledge-based protential at residue level
    LN Wei, S Fei, R Zihe - Tsinghua Science and Technology, 2003 - ieeexplore.ieee.org
     
    11. Analysis of Interactions of Buried Polar Side Chains in _-Proteins
    EV Brazhnikov, AV Efimov - Molecular Biology, 2005 - Springer
     
    12. Modeling Protein Contact Networks
    G Bagler - Arxiv preprint arXiv:0711.2616, 2007 - arxiv.org
     
    13. Structural Basis of Caspase-3 Substrate Specificity Revealed by Crystallography, Enzyme Kinetics, and Computational Modeling
    B Fang - Biology Dissertations, 2009 - digitalarchive.gsu.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch