.
The Open Protein Structure Annotation Network
PDB Keyword
.

1f38

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of MT0146/CbiT suggests that the putative precorrin-8w decarboxylase is a methyltransferase. Structure 10 1475-1487 2002
    Site NESGC
    PDB Id 1f38 Target Id TR1
    Molecular Characteristics
    Source Methanothermobacter thermautotrophicus
    Alias Ids TPS9187,PF01209, PF08241, PF09445, PF06325, PF05175, 3.40.50.150, PF03602, PF01170, PF02475, PF01135 Molecular Weight 20712.81 Da.
    Residues 192 Isoelectric Point 4.88
    Sequence mipddefiknpsvpgptamevrclimclaepgkndvavdvgcgtggvtlelagrvrrvyaidrnpeais ttemnlqrhglgdnvtlmegdapealckipdidiavvggsggelqeilriikdklkpggriivtaille tkfeameclrdlgfdvnitelniargraldrgtmmvsrnpvaliytgvshenkd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.40 Rfree 0.291
    Matthews' coefficent 2.54 Rfactor 0.236
    Waters 180 Solvent Content 51.62

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1f38
    1. Structural proteomics: toward high-throughput structural biology as a tool in functional genomics
    A Yee, K Pardee, D Christendat - Accounts of chemical , 2003 - ACS Publications
     
    2. Strategies for high_throughput comparative modeling: Applications to leverage analysis in structural genomics and protein family organization
    N Mirkovic, Z Li, A Parnassa - : Structure, Function, and , 2007 - Wiley Online Library
     
    3. Cloning, purification and preliminary crystallographic analysis of cobalamin methyltransferases from Rhodobacter capsulatus
    A Seyedarabi, T Hutchison, TT To, E Deery - Section F: Structural , 2010 - scripts.iucr.org
     
    4. Structure of the first representative of Pfam family PF04016 (DUF364) reveals enolase and Rossmann-like folds that combine to form a unique active site with a
    MD Miller, L Aravind, C Bakolitsa, CL Rife - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch