.
The Open Protein Structure Annotation Network
PDB Keyword
.

1fyw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis for signal transduction by the Toll/interleukin-1 receptor domains. Nature 408 111-115 2000
    Site NESGC
    PDB Id 1fyw Target Id HC02
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS8903,PF01582, 3.40.50.10140 Molecular Weight 17838.55 Da.
    Residues 149 Isoelectric Point 5.95
    Sequence srnixydafvsyserdaywvenlxvqelenfnppfklxlhkrdfipgkwiidniidsiekshktvfvls enfvksewxkyeldfshfrlfdenndaailillepiekkaipqrfxklrkixntktylewpxdeaqreg fwvnlraaiks
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 3.00 Rfree 0.2740000
    Matthews' coefficent Rfactor 0.2440000
    Waters Solvent Content

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1fyw
    1. A dimer of the Toll-like receptor 4 cytoplasmic domain provides a specific scaffold for the recruitment of signalling adaptor proteins
    RN Miguel, J Wong, JF Westoll, HJ Brooks, LAJ O'Neill - PLoS One, 2007 - dx.plos.org
     
    2. Structural basis for the multiple interactions of the MyD88 TIR domain in TLR4 signaling
    H Ohnishi, H Tochio, Z Kato, KE Orii - Proceedings of the , 2009 - National Acad Sciences
     
    3. Structural and functional evidence for the role of the TLR2 DD loop in TLR1/TLR2 heterodimerization and signaling
    JK Gautam, LD Comeau, JK Krueger - Journal of Biological , 2006 - ASBMB
     
    4. Evaluation of models for the evolution of protein sequences and functions under structural constraint
    S Rastogi, N Reuter, DA Liberles - Biophysical chemistry, 2006 - Elsevier
     
    5. Structural and functional analysis of a plant resistance protein TIR domain reveals interfaces for self-association, signaling, and autoregulation
    M Bernoux, T Ve, S Williams, C Warren, D Hatters - Cell host & , 2011 - Elsevier
     
    6. Inhibition of Toll-like receptors TLR4 and 7 signaling pathways by SIGIRR: A computational approach
    J Gong, T Wei, RW Stark, F Jamitzky, WM Heckl - Journal of structural , 2010 - Elsevier
     
    7. Structure and regulation of cytoplasmic adapter proteins involved in innate immune signaling
    TP Monie, MC Moncrieffe, NJ Gay - Immunological reviews, 2009 - Wiley Online Library
     
    8. Lack of SIGIRR/TIR8 aggravates hydrocarbon oil_induced lupus nephritis
    M Lech, V Skuginna, OP Kulkarni, J Gong - The Journal of , 2010 - Wiley Online Library
     
    9. In silico approach to inhibition of signaling pathways of toll-like receptors 2 and 4 by ST2L
    S Basith, B Manavalan, RG Govindaraj, S Choi - PloS one, 2011 - dx.plos.org
     
    10. TIR domain-containing adaptor SARM is a late addition to the ongoing microbehost dialog
    Q Zhang, CM Zmasek, X Cai, A Godzik - Developmental & Comparative , 2011 - Elsevier
     
    11. Role for B-cell adapter for PI3K (BCAP) as a signaling adapter linking Toll-like receptors (TLRs) to serine/threonine kinases PI3K/Akt
    TD Troutman, W Hu, S Fulenchek - Proceedings of the , 2012 - National Acad Sciences
     
    12. Comparative and phylogenetic analyses of three TIR domain-containing adaptors in metazoans: Implications for evolution of TLR signaling pathways
    B Wu, B Xin, M Jin, T Wei, Z Bai - Developmental & Comparative , 2011 - Elsevier
     
    13. Bioinformatic analysis of Toll-like receptor sequences and structures
    TP Monie, NJ Gay, M Gangloff - Methods in Molecular Biology, 2009 - Springer
     
    14. In-silico characterization of the effects of phosphorylated tyrosines 86 and 106 on structure and binding of MAL: insight into hyperinflammatory response to infection by
    UHK Niazi, J Bibby, MJ Sutcliffe - Journal of Receptors and , 2011 - informahealthcare.com
     
    15. The IL-1 receptor accessory protein TIR domain: analysis of putative interaction sites by in-vitro mutagenesis and molecular modeling
    J Radons, S Dove, D Neumann, R Altmann - The Journal of , 2003 - ppi.fli-leibniz.de
     
    16. Models of SIGIRR inhibiting the Toll-like receptor TLR4 signaling pathway
    J Gong, T Wei, RW Stark, F Jamitzky, WM Heckl - CIB'2009, 2009 - cls.zju.edu.cn
     
    17. Recognition highlights: Toll_like receptors
    DS Goodsell - Journal of Molecular Recognition, 2006 - Wiley Online Library
     
    18. Bacterial TIR-containing proteins and host innate immune system evasion
    RR Rana, M Zhang, AM Spear, HS Atkins - Medical Microbiology and , 2012 - Springer
     
    19. A dimer of the Toll-like receptor 4 cytoplasmic domain provides a specific scaffold for the recruitment of signalling adaptor proteins.
    LAJ O'NEILL - 2007 - tara.tcd.ie
     
    20. Structure-Based Reassessment of the Caveolin Signaling Model: Do Caveolae Regulate Signaling through Caveolin-Protein Interactions?
    BM Collins, MJ Davis, JF Hancock, RG Parton - Developmental Cell, 2012 - Elsevier
     
    21. IN SILICO STUDY OF HETERODIMERIZATION OF TLR2 AND TLR6
    PK Yadav, R Sachan, S Tandon, S Singh, B Gautam - globalresearchonline.net
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch