.
The Open Protein Structure Annotation Network
PDB Keyword
.

1gh8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Rapid fold and structure determination of the archaeal translation elongation factor 1beta from Methanobacterium thermoautotrophicum. J.Biomol.NMR 17 187-194 2000
    Site NESGC
    PDB Id 1gh8 Target Id TT12
    Molecular Characteristics
    Source Methanothermobacter thermautotrophicus
    Alias Ids TPS9195,PF00736, 4385, 3.30.70.60 Molecular Weight 9531.33 Da.
    Residues 89 Isoelectric Point 4.17
    Sequence mgdvvatikvmpespdvdlealkkeiqeripegtelhkideepiafglvalnvmvvvgdaeggteaaee slsgiegvsnievtdvrrlm
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1gh8
    1. Structural proteomics: toward high-throughput structural biology as a tool in functional genomics
    A Yee, K Pardee, D Christendat - Accounts of chemical , 2003 - ACS Publications
     
    2. Automatic prediction of protein domains from sequence information using a hybrid learning system
    N Nagarajan, G Yona - Bioinformatics, 2004 - Oxford Univ Press
     
    3. Characterization of polyacrylamide-stabilized Pf1 phage liquid crystals for protein NMR spectroscopy
    JF Trempe, FG Morin, Z Xia, RH Marchessault - Journal of Biomolecular , 2002 - Springer
     
    4. Are structural biases at protein termini a signature of vectorial folding?
    A Laio, C Micheletti - PROTEINS: Structure, Function, and , 2006 - Wiley Online Library
     
    5. Recognizing protein folds by cluster distance geometry
    GM Crippen - Proteins: Structure, Function, and Bioinformatics, 2005 - Wiley Online Library
     
    6. Crystal structure of TTHA0061, an uncharacterized protein from Thermus thermophilus HB8, reveals a novel fold
    T Tanaka, H Niwa, K Yutani, S Kuramitsu - Biochemical and , 2010 - Elsevier
     
    7. Crystallization and preliminary X-ray crystallographic analysis of the Sulfolobus solfataricus nucleotide-exchange factor 1
    A Ruggiero, M Masullo, P Arcari, G Raimo - Section F: Structural , 2005 - scripts.iucr.org
     
    8. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch