.
The Open Protein Structure Annotation Network
PDB Keyword
.

1h2h

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Aspartate Dehydrogenase, a Novel Enzyme Identified from Structural and Functional Studies of Tm1643. J.Biol.Chem. 278 8804 2003
    Site NESGC
    PDB Id 1h2h Target Id VT32
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS9224,3.30.360.10, PF03447, 3.40.50.720, PF01958 Molecular Weight 26638.52 Da.
    Residues 241 Isoelectric Point 7.75
    Sequence mtvliigmgnigkklvelgnfekiyaydriskdipgvvrldefqvpsdvstvvecaspeavkeyslqil knpvnyiiistsafadevfrerffselknsparvffpsgaiggldvlssikdfvknvrietikppkslg ldlkgktvvfegsveeasklfprninvastiglivgfekvkvtivadpamdhnihivrissaignyefk ienipspenpktsmltvysilrtlrnleskiifg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.6 Rfree 0.291
    Matthews' coefficent 2.4 Rfactor 0.226
    Waters 40 Solvent Content 48.9

    Ligand Information
    Ligands NAD (NICOTINAMIDE-ADENINE-DINUCLEOTIDE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1h2h
    1. Progress of structural genomics initiatives: an analysis of solved target structures
    AE Todd, RL Marsden, JM Thornton - Journal of molecular , 2005 - Elsevier
     
    2. Microbial biochemistry, physiology, and biotechnology of hyperthermophilic Thermotoga species
    SB Conners, EF Mongodin, MR Johnson - FEMS microbiology , 2006 - Wiley Online Library
     
    3. Aspartate dehydrogenase, a novel enzyme identified from structural and functional studies of TM1643
    Z Yang, A Savchenko, A Yakunin, R Zhang - Journal of Biological , 2003 - ASBMB
     
    4. Real_time ligand binding pocket database search using local surface descriptors
    R Chikhi, L Sael, D Kihara - Proteins: Structure, Function, and , 2010 - Wiley Online Library
     
    5. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     
    6. Carbohydrate utilization pathway analysis in the hyperthermophile Thermotoga maritima
    SB Conners - 2006 - repository.lib.ncsu.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch