.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ihn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of MTH938 from Methanobacterium thermoautotrophicum at 2.2 A resolution reveals a novel tertiary protein fold. Proteins 45 486-488 2001
    Site NESGC
    PDB Id 1ihn Target Id TR7
    Molecular Characteristics
    Source Methanothermobacter thermautotrophicus
    Alias Ids TPS9188,PF04430, 3.40.1230.10 Molecular Weight 12500.44 Da.
    Residues 111 Isoelectric Point 6.42
    Sequence mfsdcrfgsvtyrgreyrsdivvhvdgsvtprrkeisrrkygtshvmaeeeleelleekpesiiigsgv hgaletgfrsdatvlptceaikryneersagrrvaaiihvtc
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.266
    Matthews' coefficent 2.30 Rfactor 0.228
    Waters 80 Solvent Content 46.56

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 5

    Jmol

     
    Google Scholar output for 1ihn
    1. Structural proteomics: toward high-throughput structural biology as a tool in functional genomics
    A Yee, K Pardee, D Christendat - Accounts of chemical , 2003 - ACS Publications
     
    2. Structural characterization of proteins using residue environments
    SD Mooney, MHP Liang, R DeConde - PROTEINS: Structure, , 2005 - Wiley Online Library
     
    3. Ensemble approach to predict specificity determinants: benchmarking and validation
    S Chakrabarti, A Panchenko - BMC bioinformatics, 2009 - biomedcentral.com
     
    4. X_ray crystal structure of MTH938 from Methanobacterium thermoautotrophicum at 2.2 resolution reveals a novel tertiary protein fold
    K Das, R Xiao, E Wahlberg, F Hsu - Proteins: Structure, , 2001 - Wiley Online Library
     
    5. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch