.
The Open Protein Structure Annotation Network
PDB Keyword
.

1iy9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of spermidine synthase. To be Published
    Site NESGC
    PDB Id 1iy9 Target Id SR2
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9072,3.40.50.150, 2.30.140.10, PF01564 Molecular Weight 31334.38 Da.
    Residues 276 Isoelectric Point 5.22
    Sequence mselwytekqtknfgitmkvnktlhteqtefqhlemveteefgnmlfldgmvmtsekdefvyhemvahv plfthpnpehvlvvgggdggvireilkhpsvkkatlvdidgkvieyskkflpsiagklddprvdvqvdd gfmhiaksenqydvimvdstepvgpavnlftkgfyagiakalkedgifvaqtdnpwftpelitnvqrdv keifpitklytaniptypsglwtftigskkydplavedsrffdietkyytkdihkaafvlpkfvsdlik
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.30 Rfree 0.254
    Matthews' coefficent 2.48 Rfactor 0.208
    Waters 323 Solvent Content 50.33

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1iy9
    1. Assessment of homology_based predictions in CASP5
    A Tramontano, V Morea - Proteins: Structure, Function, and , 2003 - Wiley Online Library
     
    2. Evolutionary diversification in polyamine biosynthesis
    EG Minguet, F Vera-Sirera, A Marina, J Carbonell - Molecular biology and , 2008 - SMBE
     
    3. Structure and mechanism of spermidine synthases
    H Wu, J Min, Y Ikeguchi, H Zeng, A Dong - Biochemistry, 2007 - ACS Publications
     
    4. Using least median of squares for structural superposition of flexible proteins
    YS Liu, Y Fang, K Ramani - BMC bioinformatics, 2009 - biomedcentral.com
     
    5. Mammalian Spermidine SynthaseIdentification of Cysteine Residues and Investigation of the Putrescine Binding Site
    H Goda, T Watanabe, N Takeda, M Kobayashi - Biological and , 2004 - J-STAGE
     
    6. A fold-recognition approach to loop modeling
    C Levefelt, D Lundh - Journal of molecular modeling, 2006 - Springer
     
    7. Crystal Structures and Enzymatic Properties of a Triamine/Agmatine Aminopropyltransferase from Thermus thermophilus
    M Ohnuma, T Ganbe, Y Terui, M Niitsu, T Sato - Journal of Molecular , 2011 - Elsevier
     
    8. The crystal structure of Escherichia coli spermidine synthase SpeE reveals a unique substrate-binding pocket
    X Zhou, TK Chua, KL Tkaczuk, JM Bujnicki - Journal of structural , 2010 - Elsevier
     
    9. Protein Structure Prediction Using an Augmented Homology Modeling Method: Key Importance of Iterative-Procedures for Obtaining Consistent Quality Models
    S McDonald, S Mylvaganam - Current , 2005 - ingentaconnect.com
     
    10. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch