.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ji8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of Pyrobaculum aerophilum DsrC, an archaeal homologue of the gamma subunit of dissimilatory sulfite reductase. Eur.J.Biochem. 268 5842-5850 2001
    Site NESGC
    PDB Id 1ji8 Target Id OP1
    Molecular Characteristics
    Source Other
    Alias Ids TPS8990,1.10.10.370, 5115, 3.30.1420.10, PF04358 Molecular Weight 12668.02 Da.
    Residues 111 Isoelectric Point 5.20
    Sequence mpvkcpgeyqvdgkkvildedcfmqnpedwdekvaewlarelegiqkmteehwklvkylreywetfgsc ppikmvtketgfslekiyqlfpsgpahgackvagapkptgcv
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ji8
    1. Solution structure of Pyrobaculum aerophilum DsrC, an archaeal homologue of the gamma subunit of dissimilatory sulfite reductase
    JR Cort, SV Mariappan, CY Kim - European Journal of , 2001 - Wiley Online Library
     
    2. Energetic fitness of histidine protonation states in PDB
    GF Signorini, R Chelli, P Procacci - The Journal of Physical , 2004 - ACS Publications
     
    3. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch