.
The Open Protein Structure Annotation Network
PDB Keyword
.

1jjg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Myxoma virus immunomodulatory protein M156R is a structural mimic of eukaryotic translation initiation factor eIF2alpha. J.Mol.Biol. 322 943-954 2002
    Site NESGC
    PDB Id 1jjg Target Id OP2
    Molecular Characteristics
    Source Other
    Alias Ids TPS8991,2.40.50.140, 5077 Molecular Weight 11973.37 Da.
    Residues 102 Isoelectric Point 10.11
    Sequence mtvikpssrprprknknikvntyrtsamdlspgsvhegivyfkdgifkvrllgyeghecilldylnyrq dtldrlkerlvgrviktrvvradglyvdlrrff
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1jjg
    1. An NMR approach to structural proteomics
    A Yee, X Chang, A Pineda-Lucena - Proceedings of the , 2002 - National Acad Sciences
     
    2. Progress of structural genomics initiatives: an analysis of solved target structures
    AE Todd, RL Marsden, JM Thornton - Journal of molecular , 2005 - Elsevier
     
    3. Prediction of protein accessible surface areas by support vector regression
    Z Yuan, B Huang - Proteins: Structure, Function, and , 2004 - Wiley Online Library
     
    4. Myxoma Virus Immunomodulatory Protein M156R is a Structural Mimic of Eukaryotic Translation Initiation Factor eIF2 [alpha]
    TA Ramelot, JR Cort, AA Yee, F Liu, MB Goshe - Journal of molecular , 2002 - Elsevier
     
    5. A novel model for prediction of RNA binding proteins
    S Kikugawa, H Takehara, S Kuhara, M Kimura - Chem-Bio. Info. J, 2005 - ns.cbi.or.jp
     
    6. RNA _____________
    ______ _____ ____ ___ - CBI _____, 2005 - J-STAGE
     
    7. A Novel Model for Prediction of RNA binding Proteins
    ______ _____ ____ ___ - CBI _____, 2005 - J-STAGE
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch