.
The Open Protein Structure Annotation Network
PDB Keyword
.

1jrm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title An NMR approach to structural proteomics. Proc.Natl.Acad.Sci.USA 99 1825-1830 2002
    Site NESGC
    PDB Id 1jrm Target Id TT135
    Molecular Characteristics
    Source Methanothermobacter thermautotrophicus
    Alias Ids TPS9197,3.30.1200.10, PF02594, 5104 Molecular Weight 11861.16 Da.
    Residues 104 Isoelectric Point 9.16
    Sequence mitmdclrevgddllvnievspasgkfgipsynewrkrievkihsppqkgkanreiikefsetfgrdve ivsgqksrqktiriqgmgrdlflklvsekfgleip
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1jrm
    1. An NMR approach to structural proteomics
    A Yee, X Chang, A Pineda-Lucena - Proceedings of the , 2002 - National Acad Sciences
     
    2. Structural proteomics: toward high-throughput structural biology as a tool in functional genomics
    A Yee, K Pardee, D Christendat - Accounts of chemical , 2003 - ACS Publications
     
    3. CASP5 target classification
    LN Kinch, Y Qi, TJP Hubbard - : Structure, Function, and , 2003 - Wiley Online Library
     
    4. Structural characterization of proteins using residue environments
    SD Mooney, MHP Liang, R DeConde - PROTEINS: Structure, , 2005 - Wiley Online Library
     
    5. Are structural biases at protein termini a signature of vectorial folding?
    A Laio, C Micheletti - PROTEINS: Structure, Function, and , 2006 - Wiley Online Library
     
    6. Efficient recognition of protein fold at low sequence identity by conservative application of Psi_BLAST: validation
    FJ Stevens - Journal of Molecular Recognition, 2005 - Wiley Online Library
     
    7. Letter to the Editor: Solution structure of the hypothetical protein MTH0637 from Methanobacterium thermoautotrophicum
    A Pineda-Lucena, GS Yi, X Chang, JR Cort - Journal of Biomolecular , 2002 - Springer
     
    8. Recognizing protein folds by cluster distance geometry
    GM Crippen - Proteins: Structure, Function, and Bioinformatics, 2005 - Wiley Online Library
     
    9. Stochastic pairwise alignments and scoring methods for comparative protein structure modeling
    AC Marko, K Stafford, T Wymore - Journal of chemical information , 2007 - ACS Publications
     
    10. Structural genomics reveals EVE as a new ASCH/PUA_related domain
    C Bertonati, M Punta, M Fischer - Proteins: Structure, , 2009 - Wiley Online Library
     
    11. Quantum Proteomics
    F Pichierri - Arxiv preprint arXiv:1107.5853, 2011 - arxiv.org
     
    12. Protein Structure Prediction Using an Augmented Homology Modeling Method: Key Importance of Iterative-Procedures for Obtaining Consistent Quality Models
    S McDonald, S Mylvaganam - Current , 2005 - ingentaconnect.com
     
    13. Etude des interactions protine-protine et protine-ligand par bio-et chimie-informatique structurale: Identification de petites molcules bio-actives
    D Douguet - 2007 - hal-unice.archives-ouvertes.fr
     
    14. Best Abstracts
    C Lenormand, F Gross, H Bausinger, D Fricker - 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch