.
The Open Protein Structure Annotation Network
PDB Keyword
.

1jw2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title An NMR approach to structural proteomics. Proc.Natl.Acad.Sci.USA 99 1825-1830 2002
    Site NESGC
    PDB Id 1jw2 Target Id ET88
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8873,1.20.1280.40, 5166, PF05321 Molecular Weight 8627.54 Da.
    Residues 72 Isoelectric Point 8.79
    Sequence msekpltktdylmrlrrcqtidtlervieknkyelsdnelaeltmnklydkipssvwkfirlavfysaa dhr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1jw2
    1. Structure and function of the Escherichia coli protein YmgB: a protein critical for biofilm formation and acid-resistance
    J Lee, R Page, R Garca-Contreras - Journal of molecular , 2007 - Elsevier
     
    2. Novel approach for __helical topology prediction in globular proteins: Generation of interhelical restraints
    SR McAllister, BE Mickus, JL Klepeis - Proteins: Structure, , 2006 - Wiley Online Library
     
    3. The high-precision solution structure of Yersinia modulating protein YmoA provides insight into interaction with H-NS
    RL McFeeters, AS Altieri, S Cherry, JE Tropea - Biochemistry, 2007 - ACS Publications
     
    4. Structure of the nucleoid-associated protein Cnu reveals common binding sites for H-NS in Cnu and Hha
    SH Bae, D Liu, HM Lim, Y Lee, BS Choi - Biochemistry, 2008 - ACS Publications
     
    5. Structure prediction for the helical skeletons detected from the low resolution protein density map
    K Al Nasr, W Sun, J He - BMC bioinformatics, 2010 - biomedcentral.com
     
    6. Recognizing protein folds by cluster distance geometry
    GM Crippen - Proteins: Structure, Function, and Bioinformatics, 2005 - Wiley Online Library
     
    7. A single residue mutation in Hha preserving structure and binding to HNS results in loss of HNS mediated gene repression properties
    TN Cordeiro, JI Pons, S Aznar, A Jurez, M Pons - FEBS letters, 2008 - Elsevier
     
    8. An NMR approach to structural proteomics
    A Yee, X Chang, A Pineda-Lucena - Proceedings of the , 2002 - National Acad Sciences
     
    9. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch