.
The Open Protein Structure Annotation Network
PDB Keyword
.

1kkg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR Structure of Ribosome-binding Factor A (RbfA), A Cold-shock Adaptation Protein from Escherichia coli. J.Mol.Biol. 327 521-536 2003
    Site NESGC
    PDB Id 1kkg Target Id WR90EC
    Molecular Characteristics
    Source Caenorhabditis elegans
    Alias Ids TPS9250,5093, 3.30.300.20, PF02033 Molecular Weight 12271.73 Da.
    Residues 108 Isoelectric Point 9.00
    Sequence makefgrpqrvaqemqkeialilqreikdprlgmmttvsgvemsrdlayakvyvtflndkdedavkagi kalqeasgfirsllgkamrlrivpeltffydnslvegmr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1kkg
    1. Protein NMR recall, precision, and F-measure scores (RPF scores): structure quality assessment measures based on information retrieval statistics
    YJ Huang, R Powers - Journal of the American , 2005 - ACS Publications
     
    2. Prediction of protein tertiary structure using PROFESY, a novel method based on fragment assembly and conformational space annealing
    J Lee, SY Kim, K Joo, I Kim, J Lee - : Structure, Function, and , 2004 - Wiley Online Library
     
    3. Solution NMR structure of ribosome-binding factor A (RbfA), a cold-shock adaptation protein from Escherichia coli
    YJ Huang, GVT Swapna, PK Rajan, H Ke, B Xia - Journal of molecular , 2003 - Elsevier
     
    4. Ab initio methods
    D Chivian, T Robertson, R Bonneau - Structural , 2003 - Wiley Online Library
     
    5. The Structure of the Exopolyphosphatase (PPX) from Escherichia coli O157: H7 Suggests a Binding Mode for Long Polyphosphate Chains
    ES Rangarajan, G Nadeau, Y Li, J Wagner - Journal of molecular , 2006 - Elsevier
     
    6. Recognizing protein folds by cluster distance geometry
    GM Crippen - Proteins: Structure, Function, and Bioinformatics, 2005 - Wiley Online Library
     
    7. Exploration of the valproic acid binding site on histone deacetylase 8 using docking and molecular dynamic simulations
    JA Bermdez-Lugo, O Perez-Gonzalez - Journal of Molecular , 2011 - Springer
     
    8. A topology_constrained distance network algorithm for protein structure determination from NOESY data
    YJ Huang, R Tejero, R Powers - PROTEINS: Structure, , 2006 - Wiley Online Library
     
    9. Segmental isotope labeling of proteins for NMR structural study using a protein S tag for higher expression and solubility
    H Kobayashi, GVT Swapna, KP Wu - Journal of biomolecular , 2012 - Springer
     
    10. Accessory factors for ribosomal assembly
    M Lvgren - 2004 - umu.diva-portal.org
     
    11. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     
    12. A CONSTRAINT PROGRAMMING APPROACH FOR THE ANALYSIS OF PROTEINS CONFORMATIONS VIA FRAGMENT ASSEMBLY
    F FIORETTO - 2011 - cs.nmsu.edu
     
    13. Uso de Redes Neurais Artificiais na Simulao Monte Carlo Aplicado ao Problema de Dobramento de Protenas
    CEE TECNOLGICAS, P EM, C APLICADA - 2006 - bdtd.unisinos.br
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch