.
The Open Protein Structure Annotation Network
PDB Keyword
.

1l7b

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR Structure of the Brct Domain from Thermus Thermophilus DNA Ligase. To be Published
    Site NESGC
    PDB Id 1l7b Target Id WR64Tt
    Molecular Characteristics
    Source Caenorhabditis elegans
    Alias Ids TPS9248,PF00533, 5328, 3.40.50.10190 Molecular Weight 10013.03 Da.
    Residues 92 Isoelectric Point 9.34
    Sequence mekggealkgltfvitgelsrpreevkallrrlgakvtdsvsrktsylvvgenpgsklekaralgvptl teeelyrlleartgkkaeelvgs
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1l7b
    1. RECOORD: a recalculated coordinate database of 500+ proteins from the PDB
    AJ Nederveen, JF Doreleijers - PROTEINS: , 2005 - Wiley Online Library
     
    2. TOUCHSTONEX: Protein structure prediction with sparse NMR data
    W Li, Y Zhang, D Kihara, YJ Huang - Proteins: Structure, , 2003 - Wiley Online Library
     
    3. Characterization of the DNA binding and structural properties of the BRCT region of human replication factor C p140 subunit
    M Kobayashi, F Figaroa, N Meeuwenoord - Journal of Biological , 2006 - ASBMB
     
    4. Solution structure of polymerase _'s BRCT domain reveals an element essential for its role in nonhomologous end joining
    EF DeRose, MW Clarkson, SA Gilmore, CJ Galban - Biochemistry, 2007 - ACS Publications
     
    5. Recognizing protein folds by cluster distance geometry
    GM Crippen - Proteins: Structure, Function, and Bioinformatics, 2005 - Wiley Online Library
     
    6. NAD+-dependent DNA ligase (Rv3014c) from M. tuberculosis: Strategies for inhibitor design
    D Dube, V Kukshal, SK Srivastava, RP Tripathi - Medicinal Chemistry , 2008 - Springer
     
    7. Crystallization and preliminary X-ray diffraction analysis of motif N from Saccharomyces cerevisiae Dbf4
    LA Matthews, A Duong, AA Prasad - Section F: Structural , 2009 - scripts.iucr.org
     
    8. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     
    9. Structural and biochemical investigations of the roles of simian virus 40 Large Tumor antigen in the initiation of replication and cellular transformation
    A Kumar - 2007 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch