.
The Open Protein Structure Annotation Network
PDB Keyword
.

1l7y

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of conserved eukaryotic protein ZK652.3 from C. elegans: a ubiquitin-like fold. Proteins 48 733-736 2002
    Site NESGC
    PDB Id 1l7y Target Id WR41
    Molecular Characteristics
    Source Caenorhabditis elegans
    Alias Ids TPS9247,PF03671, 3.10.20.90, 5329 Molecular Weight 9790.73 Da.
    Residues 94 Isoelectric Point 9.60
    Sequence msggtaattagskvtfkitltsdpklpfkvlsvpestpftavlkfaaeefkvpaatsaiitndgvgvnp aqpagniflkhgselrliprdrvgh
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1l7y
    1. Post-translational regulation in plants employing a diverse set of polypeptide tags
    B Downes, RD Vierstra - Biochemical Society Transactions, 2005 - www-06.all-portland.net
     
    2. Refining homology models by combining replica_exchange molecular dynamics and statistical potentials
    J Zhu, H Fan, X Periole, B Honig - : Structure, Function, and , 2008 - Wiley Online Library
     
    3. Are structural biases at protein termini a signature of vectorial folding?
    A Laio, C Micheletti - PROTEINS: Structure, Function, and , 2006 - Wiley Online Library
     
    4. NMR structure of conserved eukaryotic protein ZK652. 3 from C. elegans: A ubiquitin_like fold
    JR Cort, Y Chiang, D Zheng - Proteins: Structure, , 2002 - Wiley Online Library
     
    5. Structural and electrostatic properties of ubiquitination and related pathways
    PJ Winn, M Zahran, JN Battey, Y Zhou, RC Wade - Front Biosci, 2007 - bioscience.org
     
    6. Recognizing protein folds by cluster distance geometry
    GM Crippen - Proteins: Structure, Function, and Bioinformatics, 2005 - Wiley Online Library
     
    7. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch