.
The Open Protein Structure Annotation Network
PDB Keyword
.

1lkn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of Hypothetical Protein tm1112. to be published
    Site NESGC
    PDB Id 1lkn Target Id VT74
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS9225,2.60.120.280, PF05899, 5357, PF07883, PF06249, 2.60.120.10 Molecular Weight 10756.93 Da.
    Residues 89 Isoelectric Point 5.50
    Sequence mevkiekptpeklkelsvekwpiwekevsefdwyydtnetcyilegkvevttedgkkyviekgdlvtfp kglrcrwkvlepvrkhynlf
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1lkn
    1. Cupins: the most functionally diverse protein superfamily?
    JM Dunwell, A Purvis, S Khuri - Phytochemistry, 2004 - Elsevier
     
    2. NMR and X-ray crystallography, complementary tools in structural proteomics of small proteins
    AA Yee, A Savchenko, A Ignachenko - Journal of the , 2005 - ACS Publications
     
    3. Microbial biochemistry, physiology, and biotechnology of hyperthermophilic Thermotoga species
    SB Conners, EF Mongodin, MR Johnson - FEMS microbiology , 2006 - Wiley Online Library
     
    4. Crystal structure of a novel Thermotoga maritima enzyme (TM1112) from the cupin family at 1.83 resolution
    D McMullan, R Schwarzenbacher - Proteins: Structure, , 2004 - Wiley Online Library
     
    5. Comparison of NMR and crystal structures for the proteins TM1112 and TM1367
    B Mohanty, P Serrano, B Pedrini - Section F: Structural , 2010 - scripts.iucr.org
     
    6. Analysis of an ankyrin-like region in Epstein Barr Virus encoded (EBV) BZLF-1 (ZEBRA) protein: implications for interactions with NF-_B and p53
    DH Dreyfus, Y Liu, LY Ghoda, JT Chang - Virology journal, 2011 - virologyj.com
     
    7. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     
    8. Carbohydrate utilization pathway analysis in the hyperthermophile Thermotoga maritima
    SB Conners - 2006 - repository.lib.ncsu.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch