.
The Open Protein Structure Annotation Network
PDB Keyword
.

1lur

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the GalM/aldose Epimerase Homologue from C. elegans, Northeast Structural Genomics Target WR66. TO BE PUBLISHED
    Site NESGC
    PDB Id 1lur Target Id WR66
    Molecular Characteristics
    Source Caenorhabditis elegans
    Alias Ids TPS9249,PF01263, 2.70.98.10 Molecular Weight 36584.86 Da.
    Residues 330 Isoelectric Point 5.34
    Sequence masgfieiankqgltatllpfgatlakltfpdkngknqdlvlgfdtidefekdaasigktvgrvanrik nstlhfdgkqytmtpnngphylhggpnglgyrkwevvrhapesvsfsvraneqddglpgdakidvtytv ndrnqliiehhatcdtpgllaltnhaywnldgsdtvaehflemeadefvevddtfcptgairsvtdtgf dfrsgkqlkesgkdaeelldldndlvitkktppstpstylrfwseksgielsittsypvihlyaskfld ckgkkgehykankalaiepqfhsaapnfdhfpdvslrpgdhycqeivytfshvn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.85 Rfree 0.262
    Matthews' coefficent 2.50 Rfactor 0.224
    Waters 398 Solvent Content 50.88

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 1lur
    1. New Synchrotron Radiation Circular Dichroism end-station on DISCO beamline at SOLEIL synchrotron for biomolecular analysis
    S Miron, M Rfregiers, AM Gilles, JC Maurizot - Biochimica et Biophysica , 2005 - Elsevier
     
    2. Structure-based Functional Annotation
    M Graille, JP Baltaze, N Leulliot, D Liger - Journal of Biological , 2006 - ASBMB
     
    3. Deciphering the function of an ORF: Salmonella enterica DeoM protein is a new mutarotase specific for deoxyribose
    L Assairi, T Bertrand, J Ferdinand - Protein , 2004 - Wiley Online Library
     
    4. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch