.
The Open Protein Structure Annotation Network
PDB Keyword
.

1lvw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of glucose-1-phosphate thymidylyltransferase, RmlA, complex with dTDP. To be Published
    Site NESGC
    PDB Id 1lvw Target Id TT5
    Molecular Characteristics
    Source Methanothermobacter thermautotrophicus
    Alias Ids TPS9206,PF00483, 3.90.550.10 Molecular Weight 33059.04 Da.
    Residues 292 Isoelectric Point 5.24
    Sequence mkgivlaggsgtrlypitravskqllpiydkpmiyyplsvlmlagirdiliistprdlplyrdllgdgs qfgvrfsyrvqeeprgiadafivgkdfigdskvalvlgdnvfyghrfseilrraasledgavifgyyvr dprpfgvvefdsegrvisieekpsrpksnyvvpglyfydnqvveiarriepsdrgeleitsvneeylrm gklrvelmgrgmawldtgthdglleassfietiqkrqgfyiacleeiaynngwitredvlemaeklekt dygkylrdlaegnfhg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.70 Rfree 0.215
    Matthews' coefficent 3.20 Rfactor 0.187
    Waters 743 Solvent Content 61.00

    Ligand Information
    Ligands SO4 (SULFATE) x 2;TYD (THYMIDINE-5'-DIPHOSPHATE) x 8;GOL (GLYCEROL) x 11
    Metals CL (CHLORIDE) x 5

    Jmol

     
    Google Scholar output for 1lvw
    1. Structural proteomics: toward high-throughput structural biology as a tool in functional genomics
    A Yee, K Pardee, D Christendat - Accounts of chemical , 2003 - ACS Publications
     
    2. Structural bioinformatic approaches to the discovery of new antimycobacterial drugs
    K Kantardjieff, B Rupp - Current pharmaceutical design, 2004 - ingentaconnect.com
     
    3. Strategies for high_throughput comparative modeling: Applications to leverage analysis in structural genomics and protein family organization
    N Mirkovic, Z Li, A Parnassa - : Structure, Function, and , 2007 - Wiley Online Library
     
    4. The complex of Sphingomonas elodea ATCC 31461 glucose-1-phosphate uridylyltransferase with glucose-1-phosphate reveals a novel quaternary structure, unique
    D Arago, AM Fialho, AR Marques - Journal of , 2007 - Am Soc Microbiol
     
    5. Cloning, expression, purification, crystallization and preliminary structure determination of glucose-1-phosphate uridylyltransferase (UgpG) from Sphingomonas
    D Aragao, AR Marques, C Frazao - Section F: Structural , 2006 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch