.
The Open Protein Structure Annotation Network
PDB Keyword
.

1lxj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURES OF MTH1187 AND ITS YEAST ORTHOLOG YBL001C. Proteins 52 478-480 2003
    Site NESGC
    PDB Id 1lxj Target Id YTYst72
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS9268,3.30.70.930, PF01910 Molecular Weight 11517.66 Da.
    Residues 104 Isoelectric Point 6.17
    Sequence mpkifcladvcmvpigtdsasisdfvaliekkiresplkstlhsagttiegpwddvmgligeiheyghe kgyvrvhtdirvgtrtdkhqtaqdkidvvlkkisq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.243
    Matthews' coefficent 3.25 Rfactor 0.211
    Waters 223 Solvent Content 62.10

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1lxj
    1. Generalized protein structure prediction based on combination of fold_recognition with de novo folding and evaluation of models
    A Koli_ski, JM Bujnicki - Proteins: Structure, Function, and , 2005 - Wiley Online Library
     
    2. Crystal structures of MTH1187 and its yeast ortholog YBL001c
    X Tao, R Khayat, D Christendat - Proteins: Structure, , 2003 - Wiley Online Library
     
    3. Crystal structure of TM1457 from Thermotoga maritima
    DH Shin, Y Lou, J Jancarik, H Yokota, R Kim - Journal of structural , 2005 - Elsevier
     
    4. Optimization of the CHARMM additive force field for DNA: Improved treatment of the BI/BII conformational equilibrium
    K Hart, N Foloppe, CM Baker, EJ Denning - Journal of Chemical , 2012 - ACS Publications
     
    5. BCL:: ContactLow Confidence Fold Recognition Hits Boost Protein Contact Prediction and De Novo Structure Determination
    M Karaka_, N Woetzel, J Meiler - Journal of Computational , 2010 - online.liebertpub.com
     
    6. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch