.
The Open Protein Structure Annotation Network
PDB Keyword
.

1m0s

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title D-RIBOSE-5-PHOSPHATE ISOMERASE, IR21. TO BE PUBLISHED
    Site NESGC
    PDB Id 1m0s Target Id IR21
    Molecular Characteristics
    Source Haemophilus influenzae
    Alias Ids TPS8934,3.40.50.1360, 3.30.70.260, PF06026 Molecular Weight 23092.38 Da.
    Residues 219 Isoelectric Point 5.08
    Sequence mnqlemkklaaqaalqyvkadtivgvgsgstvncfiealgtikdkiqgavaaskeseellrkqgievfn andvssldiyvdgadeinpqkmmikgggaaltrekivaalakkficivdsskqvdvlgstfplpvevip marsqvgrklaalggspeyregvvtdngnvildvhnfsilnpveiekelnnvagvvtngifalrgadvv ivgtpegakvid
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.2080000
    Matthews' coefficent 2.73 Rfactor 0.1790000
    Waters 332 Solvent Content 54.89

    Ligand Information
    Ligands CIT (CITRIC) x 2
    Metals

    Jmol

     
    Google Scholar output for 1m0s
    1. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    2. Shelling the Voronoi interface of proteinprotein complexes reveals patterns of residue conservation, dynamics, and composition
    B Bouvier, R Grnberg, M Nilges - : structure, function, and , 2009 - Wiley Online Library
     
    3. Coverage of protein sequence space by current structural genomics targets
    N O'Toole, S Raymond, M Cygler - Journal of Structural and Functional , 2003 - Springer
     
    4. Post to
    A Paiardini, R Sali, F Bossa - BMC structural , 2008 - biomedcentral.com
     
    5. Structure of ribose 5-phosphate isomerase from Plasmodium falciparum
    MA Holmes, FS Buckner, WC Van Voorhis - Section F: Structural , 2006 - scripts.iucr.org
     
    6. Shelling the Voronoi interface of protein-protein complexes predicts residue activity and conservation
    B Bouvier, R Gruenberg, M Nilges, F Cazals - : Structure, Function, and , 2008 - Citeseer
     
    7. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch