.
The Open Protein Structure Annotation Network
PDB Keyword
.

1mw7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-RAY STRUCTURE OF Y162_HELPY NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET PR6. To be published
    Site NESGC
    PDB Id 1mw7 Target Id PR6
    Molecular Characteristics
    Source Helicobacter pylori
    Alias Ids TPS8997,PF01709, 3.30.1270.10, 1.10.10.200, 3.30.70.980 Molecular Weight 27125.48 Da.
    Residues 240 Isoelectric Point 4.98
    Sequence mgrafeyrraakekrwdkmskvfpklakaitlaakdggsepdtnaklrtailnakaqnmpkdnidaaik rasskegnlseityegkanfgvliimecmtdnptrtianlksyfnktqgasivpngslefmfnrksvfe clknevenlklsledlefalidygleeleevedkiiirgdynsfkllnegfeslklpilkaslqriatt pielndeqmelteklldrieddddvvalytnie
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.284
    Matthews' coefficent 2.46 Rfactor 0.212
    Waters 243 Solvent Content 50.04

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1mw7
    1. 'Conserved hypothetical'proteins: prioritization of targets for experimental study
    MY Galperin, EV Koonin - Nucleic acids research, 2004 - Oxford Univ Press
     
    2. Assessment of homology_based predictions in CASP5
    A Tramontano, V Morea - Proteins: Structure, Function, and , 2003 - Wiley Online Library
     
    3. Identification of the ligand binding sites on the molecular surface of proteins
    K Kinoshita, H Nakamura - Protein Science, 2005 - Wiley Online Library
     
    4. CASP5 target classification
    LN Kinch, Y Qi, TJP Hubbard - : Structure, Function, and , 2003 - Wiley Online Library
     
    5. The YebC family protein PA0964 negatively regulates the Pseudomonas aeruginosa quinolone signal system and pyocyanin production
    H Liang, L Li, Z Dong, MG Surette - Journal of bacteriology, 2008 - Am Soc Microbiol
     
    6. A fold-recognition approach to loop modeling
    C Levefelt, D Lundh - Journal of molecular modeling, 2006 - Springer
     
    7. A seqlet-based maximum entropy Markov approach for protein secondary structure prediction
    Q Dong, X Wang, L Lin, Y Guan - Science in China Series C: Life Sciences, 2005 - Springer
     
    8. Protein Structure Prediction Using an Augmented Homology Modeling Method: Key Importance of Iterative-Procedures for Obtaining Consistent Quality Models
    S McDonald, S Mylvaganam - Current , 2005 - ingentaconnect.com
     
    9. Comparative genomics revealed a novel DNA-binding regulatory protein involved in homologous recombination in bacteria
    Y Gao, Y Zhang - (ISB), 2011 IEEE International Conference on, 2011 - ieeexplore.ieee.org
     
    10. In silico identification of a multi-functional regulatory protein involved in Holliday junction resolution in bacteria
    Y Zhang, J Lin, Y Gao - BMC Systems Biology, 2012 - biomedcentral.com
     
    11. STRUCTURAL AND FUNCTIONAL STUDIES ON THE HELICOBACTER PYLORI PROTEOME: THE STATE OF THE ART
    G Zanotti, L Cendron - Functional Proteomics & Nanotechnology- , 2010 - books.google.com
     
    12. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     
    13. Modelling Protein Structure Using Discrete Backbone Torsion Angles
    P Smith - 2010 - unsworks.unsw.edu.au
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch