.
The Open Protein Structure Annotation Network
PDB Keyword
.

1mzg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The SufE sulfur-acceptor protein contains a conserved core structure that mediates interdomain interactions in a variety of redox protein complexes. J.Mol.Biol. 344 549-565 2004
    Site NESGC
    PDB Id 1mzg Target Id ER30
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8840,3.90.1010.10, PF02657 Molecular Weight 15799.47 Da.
    Residues 138 Isoelectric Point 5.84
    Sequence mallpdkekllrnflrcanweekylyiielgqrlpelrdedrspqnsiqgcqsqvwivmrqnaqgiiel qgdsdaaivkgliavvfilydqmtpqdivnfdvrpwfekmaltqhltpsrsqgleamirairakaaals
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.251
    Matthews' coefficent 2.02 Rfactor 0.208
    Waters 185 Solvent Content 39.17

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1mzg
    1. Fe-S cluster assembly pathways in bacteria
    C Ayala-Castro, A Saini, FW Outten - Microbiology and molecular , 2008 - Am Soc Microbiol
     
    2. Structural analysis of a set of proteins resulting from a bacterial genomics project
    J Badger, JM Sauder, JM Adams - Proteins: Structure, , 2005 - Wiley Online Library
     
    3. The SufE sulfur-acceptor protein contains a conserved core structure that mediates interdomain interactions in a variety of redox protein complexes
    S Goldsmith-Fischman, A Kuzin, WC Edstrom - Journal of molecular , 2004 - Elsevier
     
    4. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    5. A new generation of statistical potentials for proteins
    Y Dehouck, D Gilis, M Rooman - Biophysical journal, 2006 - Elsevier
     
    6. High_quality homology models derived from NMR and X_ray structures of E. coli proteins YgdK and Suf E suggest that all members of the YgdK/Suf E protein family
    G Liu, Z Li, Y Chiang, T Acton, GT Montelione - Protein , 2005 - Wiley Online Library
     
    7. A fourier fingerprint-based method for protein surface representation
    MJ Bayley, EJ Gardiner, P Willett - Journal of chemical , 2005 - ACS Publications
     
    8. The structural molecular biology network of the State of So Paulo, Brazil
    JARG Barbosa, LES Netto, CS Farah - Anais da Academia , 2006 - SciELO Brasil
     
    9. Expression, crystallization and preliminary crystallographic analysis of SufE (XAC2355) from Xanthomonas axonopodis pv. citri
    CR Guzzo, LR Silva, LMP Galvo-Botton - Section F: Structural , 2006 - scripts.iucr.org
     
    10. Proteomic Analysis of Protein-Protein Interactions within the CSD Fe-S Cluster Biogenesis System
    HM Bolstad, DJ Botelho, MJ Wood - Journal of proteome research, 2010 - ACS Publications
     
    11. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch