.
The Open Protein Structure Annotation Network
PDB Keyword
.

1mzh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Aquifex Aeolicus Aldolase, Northeast Structural Genomics Consortium Target QR15. To be Published
    Site NESGC
    PDB Id 1mzh Target Id QR15
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS9039,PF01791, 3.20.20.70 Molecular Weight 24180.72 Da.
    Residues 219 Isoelectric Point 6.17
    Sequence midvrkyidnaalkphlsekeieefvlkseelgiyavcvnpyhvklassiakkvkvccvigfplglnkt svkvkeaveavrdgaqeldivwnlsafksekydfvveelkeifretpsavhkvivetpylneeeikkav eicieagadfiktstgfaprgttleevrlikssakgrikvkasggirdletaismieagadrigtssgi siaeeflkrhli
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.277
    Matthews' coefficent 2.30 Rfactor 0.223
    Waters 391 Solvent Content 46.54

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1mzh
    1. Assessment of homology_based predictions in CASP5
    A Tramontano, V Morea - Proteins: Structure, Function, and , 2003 - Wiley Online Library
     
    2. Using property based sequence motifs and 3D modeling to determine structure and functional regions of proteins
    I Ovidiu, O Numan, VS Mathura - Current medicinal , 2004 - ingentaconnect.com
     
    3. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    4. CASP5 target classification
    LN Kinch, Y Qi, TJP Hubbard - : Structure, Function, and , 2003 - Wiley Online Library
     
    5. Analysis of the class I aldolase binding site architecture based on the crystal structure of 2-deoxyribose-5-phosphate aldolase at 0.99 resolution
    A Heine, JG Luz, CH Wong, IA Wilson - Journal of molecular biology, 2004 - Elsevier
     
    6. Enzyme-driven speciation: crystallizing Archaea via lipid capture
    J Payandeh, EF Pai - Journal of molecular evolution, 2007 - Springer
     
    7. Efficient recognition of protein fold at low sequence identity by conservative application of Psi_BLAST: validation
    FJ Stevens - Journal of Molecular Recognition, 2005 - Wiley Online Library
     
    8. A fold-recognition approach to loop modeling
    C Levefelt, D Lundh - Journal of molecular modeling, 2006 - Springer
     
    9. Synthesizing non-natural parts from natural genomic template
    PK Dhar, CS Thwin, K Tun, Y Tsumoto - Journal of biological , 2009 - biomedcentral.com
     
    10. Using structural information in modeling and multiple alignments for phylogenetics
    MAS Xueliang Pan - 2008 - etd.ohiolink.edu
     
    11. Protein Structure Prediction Using an Augmented Homology Modeling Method: Key Importance of Iterative-Procedures for Obtaining Consistent Quality Models
    S McDonald, S Mylvaganam - Current , 2005 - ingentaconnect.com
     
    12. Concentration of Specific Amino Acids at the Catalytic/Active Centers of Highly-Conserved Housekeeping Enzymes of Central Metabolism in Archaea, Bacteria and
    JD Pollack, X Pan, DK Pearl - Origins of Life and Evolution of Biospheres, 2010 - Springer
     
    13. Three zone segregation of proteins-a comparison of structures
    R Sinha - Potentials, IEEE, 2006 - ieeexplore.ieee.org
     
    14. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     
    15. Protein structural classification and family identification by multifractal analysis and wavelet spectrum
    SM Zhu, ZG Yu, A Vo - Chinese Physics B, 2011 - iopscience.iop.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch