.
The Open Protein Structure Annotation Network
PDB Keyword
.

1n4a

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structures of the BtuF Periplasmic-binding Protein for Vitamin B12 Suggest a Functionally Important Reduction in Protein Mobility upon Ligand Binding. J.BIOL.CHEM. 278 8429-8434 2003
    Site NESGC
    PDB Id 1n4a Target Id EC1
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8819,PF01497, 3.40.50.1980 Molecular Weight 28015.52 Da.
    Residues 252 Isoelectric Point 7.22
    Sequence aprvitlspantelafaagitpvgvssysdyppqaqkieqvstwqgmnlerivalkpdlviawrggnae rqvdqlaslgikvmwvdatsieqianalrqlapwspqpdkaeqaaqslldqyaqlkaqyadkpkkrvfl qfginppftsgkesiqnqvlevcggenifkdsrvpwpqvsreqvlarspqaivitggpdqipkikqywg eqlkipvipltsdwferaspriilaaqqlcnalsqvdlehhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.261
    Matthews' coefficent 2.13 Rfactor 0.234
    Waters 549 Solvent Content 41.81

    Ligand Information
    Ligands CNC (CO-CYANOCOBALAMIN) x 2
    Metals

    Jmol

     
    Google Scholar output for 1n4a
    1. Crystal structures of the BtuF periplasmic-binding protein for vitamin B12 suggest a functionally important reduction in protein mobility upon ligand binding
    NK Karpowich, HH Huang, PC Smith, JF Hunt - Journal of Biological , 2003 - ASBMB
     
    2. Structural biology of bacterial iron uptake
    KD Krewulak, HJ Vogel - Biochimica et Biophysica Acta (BBA)- , 2008 - Elsevier
     
    3. Opening and closing motions in the periplasmic vitamin B12 binding protein BtuF
    C Kandt, Z Xu, DP Tieleman - Biochemistry, 2006 - ACS Publications
     
    4. A structural classification of substrate-binding proteins
    RPA Berntsson, SHJ Smits, L Schmitt, DJ Slotboom - FEBS letters, 2010 - Elsevier
     
    5. TonB or not TonB: is that the question?
    KD Krewulak, HJ Vogel - Biochemistry and Cell Biology, 2011 - ingentaconnect.com
     
    6. The crystal structure of a thermophilic glucose binding protein reveals adaptations that interconvert mono and di-saccharide binding sites
    MJ Cuneo, A Changela, JJ Warren, LS Beese - Journal of molecular , 2006 - Elsevier
     
    7. Crystallography of vitamin B 12 proteins
    L Randaccio, S Geremia, J Wuerges - Journal of organometallic chemistry, 2007 - Elsevier
     
    8. Characterization of a Bacillus subtilis transporter for petrobactin, an anthrax stealth siderophore
    AM Zawadzka, Y Kim, N Maltseva - Proceedings of the , 2009 - National Acad Sciences
     
    9. The Molecular Basis of CRL4 DDB2/CSA Ubiquitin Ligase Architecture, Targeting, and Activation
    ES Fischer, A Scrima, K Bhm, S Matsumoto - Cell, 2011 - Elsevier
     
    10. Study on the mechanism of the BtuF periplasmic-binding protein for vitamin B12
    M Liu, TG Sun, JP Hu, WZ Chen, CX Wang - Biophysical chemistry, 2008 - Elsevier
     
    11. TonB Interacts with BtuF, the Escherichia coli periplasmic binding protein for cyanocobalamin
    KJ James, MA Hancock, JN Gagnon, JW Coulton - Biochemistry, 2009 - ACS Publications
     
    12. Evaluation of the relative stability of liganded versus ligand_free protein conformations using Simplicial Neighborhood Analysis of Protein Packing (SNAPP) method
    DB Sherman, S Zhang, JB Pitner - Structure, Function, and , 2004 - Wiley Online Library
     
    13. Mobility in the structure of E. coli recQ helicase upon substrate binding as seen from molecular dynamics simulations
    N Pandey, S Govardhan, RK Pathak - Bioinformation, 2011 - ncbi.nlm.nih.gov
     
    14. A structural classification of substrate-binding proteins
    PAB Ronnie, SHJ Smits, L Schmitt, DJ Slotboom - FEBS , 2010 - gbb.eldoc.ub.rug.nl
     
    15. Exploring the structurial diversity and engineering potential of thermophilic periplasmic binding proteins
    MJ Cuneo - 2007 - dukespace.lib.duke.edu
     
    16. Axial Ligand Mutant: H229A
    NP Nguyen - Honors Theses, 2008 - digitalarchive.gsu.edu
     
    17. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch