.
The Open Protein Structure Annotation Network
PDB Keyword
.

1n6z

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title A novel member of the split beta-alpha-beta fold: Solution structure of the hypothetical protein YML108W from Saccharomyces cerevisiae. Ontario Centre for Structural Proteomics target (YST0204_1_105); Northeast Structural Genomics Target (YT601). PROTEIN SCI. 12 1136-1140 2003
    Site NESGC
    PDB Id 1n6z Target Id YT601
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS9262,PF08987, 5568, 3.10.20.250 Molecular Weight 12338.48 Da.
    Residues 105 Isoelectric Point 4.51
    Sequence msksntyrmlvlleddtkinkedekflkgkpgkmhefvdelilpfnvdeldelntwfdkfdaeicipne ghikyeissdglivlmldkeieevvekvkkfveenn
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1n6z
    1. Progress of structural genomics initiatives: an analysis of solved target structures
    AE Todd, RL Marsden, JM Thornton - Journal of molecular , 2005 - Elsevier
     
    2. Small but versatile: the extraordinary functional and structural diversity of the beta-grasp fold
    AM Burroughs, S Balaji, LM Iyer, L Aravind - Biol Direct, 2007 - biomedcentral.com
     
    3. A novel member of the split ___ fold: Solution structure of the hypothetical protein YML108W from Saccharomyces cerevisiae
    A Pineda_Lucena, JCC Liao, JR Cort, A Yee - Protein , 2003 - Wiley Online Library
     
    4. Structure and evolution of ubiquitin and ubiquitin-related domains.
    AM Burroughs, LM Iyer, L Aravind - Methods in molecular biology (Clifton, , 2012 - Springer
     
    5. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch