.
The Open Protein Structure Annotation Network
PDB Keyword
.

1n91

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Resonance assignments for the hypothetical protein yggU from Escherichia coli. J.Biomol.Nmr 27 285-286 2003
    Site NESGC
    PDB Id 1n91 Target Id ER14
    Related PDB Ids 1yh5 
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8832,3.30.1200.10, 5596, PF02594 Molecular Weight 10817.05 Da.
    Residues 100 Isoelectric Point 9.10
    Sequence mdgvmsavtvnddglvlrlyiqpkasrdsivglhgdevkvaitappvdgqanshlvkflgkqfrvaksq vviekgelgrhkqikiinpqqippevaalin
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1n91
    1. Assessment of homology_based predictions in CASP5
    A Tramontano, V Morea - Proteins: Structure, Function, and , 2003 - Wiley Online Library
     
    2. CASP5 target classification
    LN Kinch, Y Qi, TJP Hubbard - : Structure, Function, and , 2003 - Wiley Online Library
     
    3. A structural pattern_based method for protein fold recognition
    WR Taylor, I Jonassen - PROTEINS: Structure, Function, and , 2004 - Wiley Online Library
     
    4. Are structural biases at protein termini a signature of vectorial folding?
    A Laio, C Micheletti - PROTEINS: Structure, Function, and , 2006 - Wiley Online Library
     
    5. SPINS: a laboratory information management system for organizing and archiving intermediate and final results from NMR protein structure determinations
    MC Baran, HNB Moseley, JM Aramini - Proteins: Structure, , 2006 - Wiley Online Library
     
    6. Efficient recognition of protein fold at low sequence identity by conservative application of Psi_BLAST: validation
    FJ Stevens - Journal of Molecular Recognition, 2005 - Wiley Online Library
     
    7. A fold-recognition approach to loop modeling
    C Levefelt, D Lundh - Journal of molecular modeling, 2006 - Springer
     
    8. A seqlet-based maximum entropy Markov approach for protein secondary structure prediction
    Q Dong, X Wang, L Lin, Y Guan - Science in China Series C: Life Sciences, 2005 - Springer
     
    9. Crystal structure of an orphan protein (TM0875) from Thermotoga maritima at 2.00_ resolution reveals a new fold
    C Bakolitsa, R Schwarzenbacher - Proteins: Structure, , 2004 - Wiley Online Library
     
    10. Recognizing protein folds by cluster distance geometry
    GM Crippen - Proteins: Structure, Function, and Bioinformatics, 2005 - Wiley Online Library
     
    11. Stochastic pairwise alignments and scoring methods for comparative protein structure modeling
    AC Marko, K Stafford, T Wymore - Journal of chemical information , 2007 - ACS Publications
     
    12. Structural genomics reveals EVE as a new ASCH/PUA_related domain
    C Bertonati, M Punta, M Fischer - Proteins: Structure, , 2009 - Wiley Online Library
     
    13. Protein Structure Prediction Using an Augmented Homology Modeling Method: Key Importance of Iterative-Procedures for Obtaining Consistent Quality Models
    S McDonald, S Mylvaganam - Current , 2005 - ingentaconnect.com
     
    14. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch